Lineage for d1m7rb2 (1m7r B:199-586)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1167639Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1167640Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1167885Family c.45.1.3: Myotubularin-like phosphatases [102422] (1 protein)
    common fold is decorated with additional structures
  6. 1167886Protein Myotubularin-related protein 2, C-terminal domain [102423] (1 species)
  7. 1167887Species Human (Homo sapiens) [TaxId:9606] [102424] (4 PDB entries)
  8. 1167892Domain d1m7rb2: 1m7r B:199-586 [91226]
    Other proteins in same PDB: d1m7ra1, d1m7rb1
    complexed with po4

Details for d1m7rb2

PDB Entry: 1m7r (more details), 2.6 Å

PDB Description: crystal structure of myotubularin-related protein-2 (mtmr2) complexed with phosphate
PDB Compounds: (B:) Myotubularin-related Protein-2

SCOPe Domain Sequences for d1m7rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7rb2 c.45.1.3 (B:199-586) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
evfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipdeelkrv
asfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqshkifi
fdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypnieeth
wlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslamlmldgy
yrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptaf
efneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplygs
ysnhvlypvasmrhlelwvgyyirwnpr

SCOPe Domain Coordinates for d1m7rb2:

Click to download the PDB-style file with coordinates for d1m7rb2.
(The format of our PDB-style files is described here.)

Timeline for d1m7rb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m7rb1