SCOPe 2.06: Domain d1m7ra1: 1m7r A:74-198

Lineage for d1m7ra1 (1m7r A:74-198)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.8: GRAM domain [101839] (1 protein)

6. Protein Myotubularin-related protein 2, N-terminal domain [101840] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101841] (5 PDB entries)

8. Domain d1m7ra1: 1m7r A:74-198 [91223]
   Other proteins in same PDB: d1m7ra2, d1m7rb2
   complexed with po4

Details for d1m7ra1

PDB Entry: 1m7r, 2.6 Å

PDB Description: crystal structure of myotubularin-related protein-2 (mtmr2) complexed with phosphate

PDB Compounds: (A:) Myotubularin-related Protein-2

SCOPe Domain Sequences for d1m7ra1:

Sequence; same for both SEQRES and ATOM records:

>d1m7ra1 b.55.1.8 (A:74-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
eeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvin
rvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplf
afeyk

Timeline for d1m7ra1:

• d1m7ra1 first appeared in SCOP 1.67
  
• d1m7ra1 appears in SCOPe 2.05
  
• d1m7ra1 appears in SCOPe 2.07
  
• d1m7ra1 appears in the current release, SCOPe 2.08