Lineage for d1m7ra1 (1m7r A:74-198)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378377Family b.55.1.8: GRAM domain [101839] (1 protein)
  6. 378378Protein Myotubularin-related protein 2, N-terminal domain [101840] (1 species)
  7. 378379Species Human (Homo sapiens) [TaxId:9606] [101841] (2 PDB entries)
  8. 378381Domain d1m7ra1: 1m7r A:74-198 [91223]
    Other proteins in same PDB: d1m7ra2, d1m7rb2

Details for d1m7ra1

PDB Entry: 1m7r (more details), 2.6 Å

PDB Description: crystal structure of myotubularin-related protein-2 (mtmr2) complexed with phosphate

SCOP Domain Sequences for d1m7ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ra1 b.55.1.8 (A:74-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens)}
eeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvin
rvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplf
afeyk

SCOP Domain Coordinates for d1m7ra1:

Click to download the PDB-style file with coordinates for d1m7ra1.
(The format of our PDB-style files is described here.)

Timeline for d1m7ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m7ra2