![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
![]() | Protein Disabled homolog 2 (Dab2) [101830] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [101831] (2 PDB entries) |
![]() | Domain d1m7ec_: 1m7e C: [91222] complexed with peptide has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1m7e (more details), 2.45 Å
SCOPe Domain Sequences for d1m7ec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m7ec_ b.55.1.2 (C:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt gqqaeplvvdlkdlfqviynvkkkeedkkk
Timeline for d1m7ec_: