Lineage for d1m7ec_ (1m7e C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803376Protein Disabled homolog 2 (Dab2) [101830] (1 species)
  7. 2803377Species Mouse (Mus musculus) [TaxId:10090] [101831] (2 PDB entries)
  8. 2803383Domain d1m7ec_: 1m7e C: [91222]
    complexed with peptide
    has additional insertions and/or extensions that are not grouped together

Details for d1m7ec_

PDB Entry: 1m7e (more details), 2.45 Å

PDB Description: crystal structure of the phosphotyrosine binding domain(ptb) of mouse disabled 2(dab2):implications for reeling signaling
PDB Compounds: (C:) Disabled homolog 2

SCOPe Domain Sequences for d1m7ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ec_ b.55.1.2 (C:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]}
mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
gqqaeplvvdlkdlfqviynvkkkeedkkk

SCOPe Domain Coordinates for d1m7ec_:

Click to download the PDB-style file with coordinates for d1m7ec_.
(The format of our PDB-style files is described here.)

Timeline for d1m7ec_: