SCOP 1.71: Domain d1m7eb_: 1m7e B:

Lineage for d1m7eb_ (1m7e B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (9 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (10 proteins)
   Pfam 00640

6. Protein Disabled homolog 2 (Dab2) [101830] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101831] (2 PDB entries)

8. Domain d1m7eb_: 1m7e B: [91221]

Details for d1m7eb_

PDB Entry: 1m7e, 2.45 Å

PDB Description: crystal structure of the phosphotyrosine binding domain(ptb) of mouse disabled 2(dab2):implications for reeling signaling

SCOP Domain Sequences for d1m7eb_:

Sequence; same for both SEQRES and ATOM records:

>d1m7eb_ b.55.1.2 (B:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus)}
mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
gqqaeplvvdlkdlfqviynvkkkeedkkk

Timeline for d1m7eb_:

• d1m7eb_ first appeared in SCOP 1.67
  
• d1m7eb_ appears in SCOP 1.69
  
• d1m7eb_ appears in SCOP 1.73
  
• d1m7eb_ appears in the current release, SCOPe 2.08