Lineage for d1m7eb_ (1m7e B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378247Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (8 proteins)
  6. 378254Protein Disabled homolog 2 (Dab2) [101830] (1 species)
  7. 378255Species Mouse (Mus musculus) [TaxId:10090] [101831] (2 PDB entries)
  8. 378260Domain d1m7eb_: 1m7e B: [91221]

Details for d1m7eb_

PDB Entry: 1m7e (more details), 2.45 Å

PDB Description: crystal structure of the phosphotyrosine binding domain(ptb) of mouse disabled 2(dab2):implications for reeling signaling

SCOP Domain Sequences for d1m7eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7eb_ b.55.1.2 (B:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus)}
mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
gqqaeplvvdlkdlfqviynvkkkeedkkk

SCOP Domain Coordinates for d1m7eb_:

Click to download the PDB-style file with coordinates for d1m7eb_.
(The format of our PDB-style files is described here.)

Timeline for d1m7eb_: