SCOP 1.73: Domain d1m76a1: 1m76 A:204-302

Lineage for d1m76a1 (1m76 A:204-302)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
   Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI

7. Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries)

8. Domain d1m76a1: 1m76 A:204-302 [91216]
   Other proteins in same PDB: d1m76a2, d1m76b2

Details for d1m76a1

PDB Entry: 1m76, 2.15 Å

PDB Description: crystal structure of the s137c mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad and acetoacetyl-coa

PDB Compounds: (A:) 3-hydroxyacyl-CoA dehydrogenase

SCOP Domain Sequences for d1m76a1:

Sequence; same for both SEQRES and ATOM records:

>d1m76a1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

Timeline for d1m76a1:

• d1m76a1 first appeared in SCOP 1.67
  
• d1m76a1 appears in SCOP 1.71
  
• d1m76a1 appears in SCOP 1.75
  
• d1m76a1 appears in the current release, SCOPe 2.08