Lineage for d1m72b_ (1m72 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100990Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2100991Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2100992Family c.17.1.1: Caspase catalytic domain [52130] (8 protein domains)
  6. 2101034Protein Caspase-1 [102526] (1 species)
  7. 2101035Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [102527] (1 PDB entry)
  8. 2101037Domain d1m72b_: 1m72 B: [91209]
    Other proteins in same PDB: d1m72c2
    complexed with edo

Details for d1m72b_

PDB Entry: 1m72 (more details), 2.3 Å

PDB Description: Crystal Structure of Caspase-1 from Spodoptera frugiperda
PDB Compounds: (B:) Caspase-1

SCOPe Domain Sequences for d1m72b_:

Sequence, based on SEQRES records: (download)

>d1m72b_ c.17.1.1 (B:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
varmpvdrnapyynmnhkhrgmaiifnhehfdihslksrtgtnvdsdnlskvlktlgfkv
tvfpnlkseeinkfiqqtaemdhsdadcllvavlthgelgmlyakdthykpdnlwyyfta
dkcptlagkpklffiqacqgdrldggitlsrtetdgspstsyripvhadfliafstvpgy
fswrnttrgswfmqalceelryagterdiltlltfvcqkvaldfesnapdsammhqqkqv
pcitsmltrllvfgkk

Sequence, based on observed residues (ATOM records): (download)

>d1m72b_ c.17.1.1 (B:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
varmpvdrnapyynmnhkhrgmaiifnhehfdihslksrtgtnvdsdnlskvlktlgfkv
tvfpnlkseeinkfiqqtaemdhsdadcllvavlthgelgmlyakdthykpdnlwyyfta
dkcptlagkpklffiqacqgdrldggitlsrtsyripvhadfliafstvpgyfswrnttr
gswfmqalceelryagterdiltlltfvcqkvaldfesnapdsammhqqkqvpcitsmlt
rllvfgkk

SCOPe Domain Coordinates for d1m72b_:

Click to download the PDB-style file with coordinates for d1m72b_.
(The format of our PDB-style files is described here.)

Timeline for d1m72b_: