| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins) duplication: consists of two cytochrome c type domains |
| Protein Cytochrome c4 [46681] (2 species) |
| Species Pseudomonas stutzeri [TaxId:316] [46682] (3 PDB entries) |
| Domain d1m70c2: 1m70 C:93-190 [91205] complexed with gol, hec |
PDB Entry: 1m70 (more details), 1.25 Å
SCOPe Domain Sequences for d1m70c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m70c2 a.3.1.4 (C:93-190) Cytochrome c4 {Pseudomonas stutzeri [TaxId: 316]}
gyadpalakqgeklfrggkldqgmpactgchapngvgndlagfpklggqhaaytakqltd
fregnrtndgdtmimrgvaaklsnkdiealssyiqglh
Timeline for d1m70c2: