SCOPe 2.05: Domain d1m70c1: 1m70 C:1-92

Lineage for d1m70c1 (1m70 C:1-92)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
   duplication: consists of two cytochrome c type domains

6. Protein Cytochrome c4 [46681] (2 species)

7. Species Pseudomonas stutzeri [TaxId:316] [46682] (3 PDB entries)

8. Domain d1m70c1: 1m70 C:1-92 [91204]
   complexed with gol, hec

Details for d1m70c1

PDB Entry: 1m70, 1.25 Å

PDB Description: crystal structure of oxidized recombinant cytochrome c4 from pseudomonas stutzeri

PDB Compounds: (C:) cytochrome c4

SCOPe Domain Sequences for d1m70c1:

Sequence; same for both SEQRES and ATOM records:

>d1m70c1 a.3.1.4 (C:1-92) Cytochrome c4 {Pseudomonas stutzeri [TaxId: 316]}
agdaeagqgkvavcgachgvdgnspapnfpklagqgeryllkqlqdikagstpgapegvg
rkvlemtgmldplsdqdlediaayfssqkgsv

Timeline for d1m70c1:

• d1m70c1 first appeared in SCOP 1.67
  
• d1m70c1 appears in SCOPe 2.04
  
• d1m70c1 appears in SCOPe 2.06
  
• d1m70c1 appears in the current release, SCOPe 2.08