Lineage for d1m70c1 (1m70 C:1-92)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304260Family a.3.1.4: Two-domain cytochrome c [46680] (3 protein domains)
    duplication: consists of two cytochrome c type domains
  6. 2304261Protein Cytochrome c4 [46681] (2 species)
  7. 2304262Species Pseudomonas stutzeri [TaxId:316] [46682] (3 PDB entries)
  8. 2304267Domain d1m70c1: 1m70 C:1-92 [91204]
    complexed with gol, hec

Details for d1m70c1

PDB Entry: 1m70 (more details), 1.25 Å

PDB Description: Crystal structure of oxidized recombinant cytochrome c4 from Pseudomonas stutzeri
PDB Compounds: (C:) cytochrome c4

SCOPe Domain Sequences for d1m70c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m70c1 a.3.1.4 (C:1-92) Cytochrome c4 {Pseudomonas stutzeri [TaxId: 316]}
agdaeagqgkvavcgachgvdgnspapnfpklagqgeryllkqlqdikagstpgapegvg
rkvlemtgmldplsdqdlediaayfssqkgsv

SCOPe Domain Coordinates for d1m70c1:

Click to download the PDB-style file with coordinates for d1m70c1.
(The format of our PDB-style files is described here.)

Timeline for d1m70c1: