Lineage for d1m6zd1 (1m6z D:1-92)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1477349Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
    duplication: consists of two cytochrome c type domains
  6. 1477350Protein Cytochrome c4 [46681] (2 species)
  7. 1477351Species Pseudomonas stutzeri [TaxId:316] [46682] (3 PDB entries)
  8. 1477366Domain d1m6zd1: 1m6z D:1-92 [91198]
    complexed with gol, hec, trs

Details for d1m6zd1

PDB Entry: 1m6z (more details), 1.35 Å

PDB Description: crystal structure of reduced recombinant cytochrome c4 from pseudomonas stutzeri
PDB Compounds: (D:) cytochrome c4

SCOPe Domain Sequences for d1m6zd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6zd1 a.3.1.4 (D:1-92) Cytochrome c4 {Pseudomonas stutzeri [TaxId: 316]}
agdaeagqgkvavcgachgvdgnspapnfpklagqgeryllkqlqdikagstpgapegvg
rkvlemtgmldplsdqdlediaayfssqkgsv

SCOPe Domain Coordinates for d1m6zd1:

Click to download the PDB-style file with coordinates for d1m6zd1.
(The format of our PDB-style files is described here.)

Timeline for d1m6zd1: