Lineage for d1m6zc2 (1m6z C:93-190)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 350824Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 350825Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 351152Family a.3.1.4: Two-domain cytochrome c [46680] (2 proteins)
    duplication: consists of two cytochrome c type domains
  6. 351153Protein Cytochrome c4 [46681] (2 species)
  7. 351154Species Pseudomonas stutzeri [TaxId:316] [46682] (3 PDB entries)
  8. 351168Domain d1m6zc2: 1m6z C:93-190 [91197]

Details for d1m6zc2

PDB Entry: 1m6z (more details), 1.35 Å

PDB Description: crystal structure of reduced recombinant cytochrome c4 from pseudomonas stutzeri

SCOP Domain Sequences for d1m6zc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6zc2 a.3.1.4 (C:93-190) Cytochrome c4 {Pseudomonas stutzeri}
gyadpalakqgeklfrggkldqgmpactgchapngvgndlagfpklggqhaaytakqltd
fregnrtndgdtmimrgvaaklsnkdiealssyiqglh

SCOP Domain Coordinates for d1m6zc2:

Click to download the PDB-style file with coordinates for d1m6zc2.
(The format of our PDB-style files is described here.)

Timeline for d1m6zc2: