| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins) duplication: consists of two cytochrome c type domains |
| Protein Cytochrome c4 [46681] (2 species) |
| Species Pseudomonas stutzeri [TaxId:316] [46682] (3 PDB entries) |
| Domain d1m6za1: 1m6z A:1-92 [91192] complexed with gol, hec, trs |
PDB Entry: 1m6z (more details), 1.35 Å
SCOPe Domain Sequences for d1m6za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m6za1 a.3.1.4 (A:1-92) Cytochrome c4 {Pseudomonas stutzeri [TaxId: 316]}
agdaeagqgkvavcgachgvdgnspapnfpklagqgeryllkqlqdikagstpgapegvg
rkvlemtgmldplsdqdlediaayfssqkgsv
Timeline for d1m6za1: