SCOP 1.67: Domain d1m6oa2: 1m6o A:1-181

Lineage for d1m6oa2 (1m6o A:1-181)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)

7. Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (2 PDB entries)

8. Domain d1m6oa2: 1m6o A:1-181 [91190]
   Other proteins in same PDB: d1m6oa1, d1m6ob_

Details for d1m6oa2

PDB Entry: 1m6o, 1.6 Å

PDB Description: Crystal Structure of HLA B*4402 in complex with HLA DPA*0201 peptide

SCOP Domain Sequences for d1m6oa2:

Sequence; same for both SEQRES and ATOM records:

>d1m6oa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44}
gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw
dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqdrayleglcveslrrylengketlq
r

Timeline for d1m6oa2:

• d1m6oa2 is new in SCOP 1.67
  
• d1m6oa2 appears in SCOP 1.69
  
• d1m6oa2 appears in the current release, SCOPe 2.08