Lineage for d1m51a2 (1m51 A:10-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149702Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2149703Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2149704Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 protein domains)
  6. 2149705Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 2149706Species Human (Homo sapiens) [TaxId:9606] [69616] (7 PDB entries)
  8. 2149710Domain d1m51a2: 1m51 A:10-259 [91187]
    Other proteins in same PDB: d1m51a1
    complexed with act, edo, mn, tsx

Details for d1m51a2

PDB Entry: 1m51 (more details), 2.25 Å

PDB Description: PEPCK complex with a GTP-competitive inhibitor
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic

SCOPe Domain Sequences for d1m51a2:

Sequence, based on SEQRES records: (download)

>d1m51a2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]}
nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl
kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar
fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef
vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr
masrlakeeg

Sequence, based on observed residues (ATOM records): (download)

>d1m51a2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]}
nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl
kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar
fpgcmkgrtmyvipfsmgplgsskigieltdspyvvasmrimtrmgtpvlealgdgefvk
clhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalrma
srlakeeg

SCOPe Domain Coordinates for d1m51a2:

Click to download the PDB-style file with coordinates for d1m51a2.
(The format of our PDB-style files is described here.)

Timeline for d1m51a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m51a1