SCOPe 2.03: Domain d1m3qa1: 1m3q A:136-325

Lineage for d1m3qa1 (1m3q A:136-325)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries)

8. Domain d1m3qa1: 1m3q A:136-325 [91184]
   Other proteins in same PDB: d1m3qa2
   protein/DNA complex; complexed with ang, ca; mutant

Details for d1m3qa1

PDB Entry: 1m3q, 1.9 Å

PDB Description: crystal structure of hogg1 d268e mutant with base-excised dna and 8- aminoguanine

PDB Compounds: (A:) 8-oxoguanine DNA glycosylase

SCOPe Domain Sequences for d1m3qa1:

Sequence; same for both SEQRES and ATOM records:

>d1m3qa1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvevhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

Timeline for d1m3qa1:

• d1m3qa1 first appeared in SCOP 1.67
  
• d1m3qa1 appears in SCOPe 2.02
  
• d1m3qa1 appears in SCOPe 2.04
  
• d1m3qa1 appears in the current release, SCOPe 2.08