SCOPe 2.06: Domain d1m3ha2: 1m3h A:12-135

Lineage for d1m3ha2 (1m3h A:12-135)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
   contains a single copy of this fold

6. Protein 8-oxoguanine glycosylase [55955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)

8. Domain d1m3ha2: 1m3h A:12-135 [91177]
   Other proteins in same PDB: d1m3ha1, d1m3ha3
   protein/DNA complex; complexed with ca; mutant

Details for d1m3ha2

PDB Entry: 1m3h, 2.05 Å

PDB Description: Crystal Structure of Hogg1 D268E Mutant with Product Oligonucleotide

PDB Compounds: (A:) 8-oxoguanine DNA glycosylase

SCOPe Domain Sequences for d1m3ha2:

Sequence, based on SEQRES records:

>d1m3ha2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Sequence, based on observed residues (ATOM records):

>d1m3ha2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllr
q

Timeline for d1m3ha2:

• d1m3ha2 first appeared in SCOP 1.67
  
• d1m3ha2 appears in SCOPe 2.05
  
• d1m3ha2 appears in the current release, SCOPe 2.07