SCOP 1.73: Domain d1m3ha1: 1m3h A:136-325

Lineage for d1m3ha1 (1m3h A:136-325)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (6 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48161] (23 PDB entries)

8. Domain d1m3ha1: 1m3h A:136-325 [91176]
   Other proteins in same PDB: d1m3ha2
   complexed with ca, ddx; mutant

Details for d1m3ha1

PDB Entry: 1m3h, 2.05 Å

PDB Description: crystal structure of hogg1 d268e mutant with product oligonucleotide

PDB Compounds: (A:) 8-oxoguanine DNA glycosylase

SCOP Domain Sequences for d1m3ha1:

Sequence; same for both SEQRES and ATOM records:

>d1m3ha1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvevhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

Timeline for d1m3ha1:

• d1m3ha1 first appeared in SCOP 1.67
  
• d1m3ha1 appears in SCOP 1.71
  
• d1m3ha1 appears in SCOP 1.75
  
• d1m3ha1 appears in the current release, SCOPe 2.08