Lineage for d1m3aa_ (1m3a A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053796Protein C-Crk, N-terminal SH3 domain [50046] (1 species)
  7. 2053797Species Mouse (Mus musculus) [TaxId:10090] [50047] (8 PDB entries)
  8. 2053803Domain d1m3aa_: 1m3a A: [91173]
    a circular form

Details for d1m3aa_

PDB Entry: 1m3a (more details)

PDB Description: solution structure of a circular form of the truncated n-terminal sh3 domain from oncogene protein c-crk.
PDB Compounds: (A:) Proto-oncogene C-crk

SCOPe Domain Sequences for d1m3aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3aa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
cyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyvekyg

SCOPe Domain Coordinates for d1m3aa_:

Click to download the PDB-style file with coordinates for d1m3aa_.
(The format of our PDB-style files is described here.)

Timeline for d1m3aa_: