![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
![]() | Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
![]() | Family g.37.1.2: C2HC finger [57697] (3 proteins) |
![]() | Protein Monocytic leukemia zinc finger protein Moz [103599] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103600] (1 PDB entry) this zinc finger is only a fragment of a bigger subdomain in the structure of functional HAT domain (143703) |
![]() | Domain d1m36a1: 1m36 A:3-33 [91172] Other proteins in same PDB: d1m36a2 complexed with zn |
PDB Entry: 1m36 (more details)
SCOPe Domain Sequences for d1m36a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m36a1 g.37.1.2 (A:3-33) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} rlpklylcefclkymksrtilqqhmkkcgwf
Timeline for d1m36a1: