Lineage for d1m36a1 (1m36 A:3-33)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035480Family g.37.1.2: C2HC finger [57697] (3 proteins)
  6. 3035485Protein Monocytic leukemia zinc finger protein Moz [103599] (1 species)
  7. 3035486Species Human (Homo sapiens) [TaxId:9606] [103600] (1 PDB entry)
    this zinc finger is only a fragment of a bigger subdomain in the structure of functional HAT domain (143703)
  8. 3035487Domain d1m36a1: 1m36 A:3-33 [91172]
    Other proteins in same PDB: d1m36a2
    complexed with zn

Details for d1m36a1

PDB Entry: 1m36 (more details)

PDB Description: solution structure of a cchc zinc finger from moz
PDB Compounds: (A:) Monocytic leukemia zinc finger protein

SCOPe Domain Sequences for d1m36a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m36a1 g.37.1.2 (A:3-33) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]}
rlpklylcefclkymksrtilqqhmkkcgwf

SCOPe Domain Coordinates for d1m36a1:

Click to download the PDB-style file with coordinates for d1m36a1.
(The format of our PDB-style files is described here.)

Timeline for d1m36a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m36a2