Lineage for d1m2sa_ (1m2s A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635336Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 2635365Protein Bmtx3 [103542] (1 species)
  7. 2635366Species Chinese scorpion (Buthus martensii karsch) [TaxId:34649] [103543] (1 PDB entry)
  8. 2635367Domain d1m2sa_: 1m2s A: [91170]

Details for d1m2sa_

PDB Entry: 1m2s (more details)

PDB Description: solution structure of a new potassium channels blocker from the venom of chinese scorpion buthus martensi karsch
PDB Compounds: (A:) Toxin BmTX3

SCOPe Domain Sequences for d1m2sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2sa_ g.3.7.2 (A:) Bmtx3 {Chinese scorpion (Buthus martensii karsch) [TaxId: 34649]}
fglidvkcfassecwtackkvtgsgqgkcqnnqcrcy

SCOPe Domain Coordinates for d1m2sa_:

Click to download the PDB-style file with coordinates for d1m2sa_.
(The format of our PDB-style files is described here.)

Timeline for d1m2sa_: