Lineage for d1m1lb_ (1m1l B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009094Fold d.260: Suppressor of Fused, N-terminal domain [103358] (1 superfamily)
    unusual fold; bifurcated beta-sheet; left-handed beta-alpha-beta unit
  4. 3009095Superfamily d.260.1: Suppressor of Fused, N-terminal domain [103359] (2 families) (S)
  5. 3009096Family d.260.1.1: Suppressor of Fused, N-terminal domain [103360] (1 protein)
  6. 3009097Protein Suppressor of Fused, N-terminal domain [103361] (1 species)
  7. 3009098Species Human (Homo sapiens) [TaxId:9606] [103362] (1 PDB entry)
  8. 3009100Domain d1m1lb_: 1m1l B: [91167]

Details for d1m1lb_

PDB Entry: 1m1l (more details), 2.65 Å

PDB Description: Human Suppressor of Fused (N-terminal domain)
PDB Compounds: (B:) Suppressor of Fused

SCOPe Domain Sequences for d1m1lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1lb_ d.260.1.1 (B:) Suppressor of Fused, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
aslfppglhaiygecrrlypdqpnplqvtaivkywlggpdpldyvsmyrnvgspsanipe
hwhyisfglsdlygdnrvheftgtdgpsgfgfeltfrlkretgesapptwpaelmqglar
yvfqsentfcsgdhvswhspldnsesriqhmlltedpqmqpvqtpfgvvtflqivgvcte
elhsaqqwngqgilellrtvpiaggpwlitdmrrgetifeidphlqervdkgietd

SCOPe Domain Coordinates for d1m1lb_:

Click to download the PDB-style file with coordinates for d1m1lb_.
(The format of our PDB-style files is described here.)

Timeline for d1m1lb_: