SCOPe 2.01: Domain d1m16a_: 1m16 A:

Lineage for d1m16a_ (1m16 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (31 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1m16a_: 1m16 A: [91164]
   complexed with fmt, so4

Details for d1m16a_

PDB Entry: 1m16, 1.7 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced with phe (l44f), leu 73 replaced with val (l73v), val 109 replaced with leu (v109l) and cys 117 replaced with val (c117v).

PDB Compounds: (A:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1m16a_:

Sequence; same for both SEQRES and ATOM records:

>d1m16a_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevy
ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
svkrgprthygqkailflplpv

Timeline for d1m16a_:

• d1m16a_ first appeared in SCOP 1.67
  
• d1m16a_ appears in SCOP 1.75
  
• d1m16a_ appears in SCOPe 2.02
  
• d1m16a_ appears in the current release, SCOPe 2.08