Lineage for d1m16a_ (1m16 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464259Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 464260Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)
  6. 464261Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 464275Species Human (Homo sapiens) [TaxId:9606] [50359] (26 PDB entries)
  8. 464296Domain d1m16a_: 1m16 A: [91164]

Details for d1m16a_

PDB Entry: 1m16 (more details), 1.7 Å

PDB Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced with phe (l44f), leu 73 replaced with val (l73v), val 109 replaced with leu (v109l) and cys 117 replaced with val (c117v).

SCOP Domain Sequences for d1m16a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m16a_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens)}
hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevy
ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
svkrgprthygqkailflplpv

SCOP Domain Coordinates for d1m16a_:

Click to download the PDB-style file with coordinates for d1m16a_.
(The format of our PDB-style files is described here.)

Timeline for d1m16a_: