Lineage for d1m05c2 (1m05 C:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600327Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries)
  8. 600330Domain d1m05c2: 1m05 C:1-181 [91160]
    Other proteins in same PDB: d1m05a1, d1m05b_, d1m05c1, d1m05d_
    complexed with cd; mutant

Details for d1m05c2

PDB Entry: 1m05 (more details), 1.9 Å

PDB Description: hla b8 in complex with an epstein barr virus determinant

SCOP Domain Sequences for d1m05c2:

Sequence, based on SEQRES records: (download)

>d1m05c2 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

Sequence, based on observed residues (ATOM records): (download)

>d1m05c2 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaapwieqegpeywdrntqifk
tntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydgkdyialne
dlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtler

SCOP Domain Coordinates for d1m05c2:

Click to download the PDB-style file with coordinates for d1m05c2.
(The format of our PDB-style files is described here.)

Timeline for d1m05c2: