SCOP 1.73: Domain d1m05c1: 1m05 C:182-277

Lineage for d1m05c1 (1m05 C:182-277)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)

8. Domain d1m05c1: 1m05 C:182-277 [91159]
   Other proteins in same PDB: d1m05a2, d1m05b_, d1m05c2, d1m05d_
   complexed with cd; mutant

Details for d1m05c1

PDB Entry: 1m05, 1.9 Å

PDB Description: hla b8 in complex with an epstein barr virus determinant

PDB Compounds: (C:) HLA class I histocompatibility antigen, B-8 B*0801 alpha chain

SCOP Domain Sequences for d1m05c1:

Sequence; same for both SEQRES and ATOM records:

>d1m05c1 b.1.1.2 (C:182-277) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrweps

Timeline for d1m05c1:

• d1m05c1 first appeared in SCOP 1.67
  
• d1m05c1 appears in SCOP 1.71
  
• d1m05c1 appears in SCOP 1.75
  
• d1m05c1 appears in the current release, SCOPe 2.08