Lineage for d1m05a2 (1m05 A:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198164Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries)
  8. 1198166Domain d1m05a2: 1m05 A:1-181 [91157]
    Other proteins in same PDB: d1m05a1, d1m05b_, d1m05c1, d1m05d_
    complexed with cd

Details for d1m05a2

PDB Entry: 1m05 (more details), 1.9 Å

PDB Description: hla b8 in complex with an epstein barr virus determinant
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-8 B*0801 alpha chain

SCOPe Domain Sequences for d1m05a2:

Sequence, based on SEQRES records: (download)

>d1m05a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08 [TaxId: 9606]}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

Sequence, based on observed residues (ATOM records): (download)

>d1m05a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08 [TaxId: 9606]}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaapwieqegpeywdrntqifk
tntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydgkdyialne
dlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtler

SCOPe Domain Coordinates for d1m05a2:

Click to download the PDB-style file with coordinates for d1m05a2.
(The format of our PDB-style files is described here.)

Timeline for d1m05a2: