SCOP 1.67: Domain d1lxyb_: 1lxy B:

Lineage for d1lxyb_ (1lxy B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (4 families)

5. Family d.126.1.4: Arginine deiminase [103232] (1 protein)
   functionally related to the amidinotransferase, similar active sites

6. Protein Arginine deiminase [103233] (2 species)

7. Species Mycoplasma arginini [TaxId:2094] [103235] (2 PDB entries)

8. Domain d1lxyb_: 1lxy B: [91155]
   complexed with cir, trs

Details for d1lxyb_

PDB Entry: 1lxy, 2 Å

PDB Description: Crystal Structure of Arginine Deiminase covalently linked with L-citrulline

SCOP Domain Sequences for d1lxyb_:

Sequence; same for both SEQRES and ATOM records:

>d1lxyb_ d.126.1.4 (B:) Arginine deiminase {Mycoplasma arginini}
svfdskfkgihvyseigelesvlvhepgreidyitparldellfsaileshdarkehkqf
vaelkandinvvelidlvaetydlasqeakdklieefledsepvlseehkvvvrnflkak
ktsrelveimmagitkydlgieadhelivdpmpnlyftrdpfasvgngvtihymrykvrq
retlfsrfvfsnhpklintpwyydpslklsieggdvfiynndtlvvgvsertdlqtvtll
aknivankecefkrivainvpkwtnlmhldtwltmldkdkflyspiandvfkfwdydlvn
ggaepqpvenglplegllqsiinkkpvlipiagegasqmeierethfdgtnylairpgvv
igysrnektnaaleaagikvlpfhgnqlslgmgnarcmsmplsrkdvkw

Timeline for d1lxyb_:

• d1lxyb_ is new in SCOP 1.67
  
• d1lxyb_ appears in SCOP 1.69
  
• d1lxyb_ appears in the current release, SCOPe 2.08