Lineage for d1lxya_ (1lxy A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510635Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 510636Superfamily d.126.1: Pentein [55909] (6 families) (S)
  5. 510666Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 510667Protein Arginine deiminase [103233] (2 species)
  7. 510668Species Mycoplasma arginini [TaxId:2094] [103235] (2 PDB entries)
  8. 510671Domain d1lxya_: 1lxy A: [91154]

Details for d1lxya_

PDB Entry: 1lxy (more details), 2 Å

PDB Description: Crystal Structure of Arginine Deiminase covalently linked with L-citrulline

SCOP Domain Sequences for d1lxya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxya_ d.126.1.4 (A:) Arginine deiminase {Mycoplasma arginini}
svfdskfkgihvyseigelesvlvhepgreidyitparldellfsaileshdarkehkqf
vaelkandinvvelidlvaetydlasqeakdklieefledsepvlseehkvvvrnflkak
ktsrelveimmagitkydlgieadhelivdpmpnlyftrdpfasvgngvtihymrykvrq
retlfsrfvfsnhpklintpwyydpslklsieggdvfiynndtlvvgvsertdlqtvtll
aknivankecefkrivainvpkwtnlmhldtwltmldkdkflyspiandvfkfwdydlvn
ggaepqpvenglplegllqsiinkkpvlipiagegasqmeierethfdgtnylairpgvv
igysrnektnaaleaagikvlpfhgnqlslgmgnarcmsmplsrkdvkw

SCOP Domain Coordinates for d1lxya_:

Click to download the PDB-style file with coordinates for d1lxya_.
(The format of our PDB-style files is described here.)

Timeline for d1lxya_: