Lineage for d1lw3a1 (1lw3 A:74-198)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957214Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 957215Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 957695Family b.55.1.8: GRAM domain [101839] (1 protein)
  6. 957696Protein Myotubularin-related protein 2, N-terminal domain [101840] (1 species)
  7. 957697Species Human (Homo sapiens) [TaxId:9606] [101841] (4 PDB entries)
  8. 957700Domain d1lw3a1: 1lw3 A:74-198 [91152]
    Other proteins in same PDB: d1lw3a2
    complexed with po4

Details for d1lw3a1

PDB Entry: 1lw3 (more details), 2.3 Å

PDB Description: crystal structure of myotubularin-related protein 2 complexed with phosphate
PDB Compounds: (A:) Myotubularin-related protein 2

SCOPe Domain Sequences for d1lw3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lw3a1 b.55.1.8 (A:74-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
eeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvin
rvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplf
afeyk

SCOPe Domain Coordinates for d1lw3a1:

Click to download the PDB-style file with coordinates for d1lw3a1.
(The format of our PDB-style files is described here.)

Timeline for d1lw3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lw3a2