Lineage for d1lvuf_ (1lvu F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2887952Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)
  7. 2887976Species Cow (Bos taurus) [TaxId:9913] [53171] (20 PDB entries)
    Uniprot P55859
  8. 2888005Domain d1lvuf_: 1lvu F: [91151]
    complexed with 9pp, ca

Details for d1lvuf_

PDB Entry: 1lvu (more details), 2.05 Å

PDB Description: crystal structure of calf spleen purine nucleoside phosphorylase in a new space group with full trimer in the asymmetric unit
PDB Compounds: (F:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1lvuf_:

Sequence, based on SEQRES records: (download)

>d1lvuf_ c.56.2.1 (F:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}
mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
itnkvimdyesqgkanheevleagkqaaqkleqfvsllmasipv

Sequence, based on observed residues (ATOM records): (download)

>d1lvuf_ c.56.2.1 (F:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}
mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
itnkvimdyeqaaqkleqfvsllmasipv

SCOPe Domain Coordinates for d1lvuf_:

Click to download the PDB-style file with coordinates for d1lvuf_.
(The format of our PDB-style files is described here.)

Timeline for d1lvuf_: