SCOP 1.73: Domain d1lvuc_: 1lvu C:

Lineage for d1lvuc_ (1lvu C:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53171] (19 PDB entries)

8. Domain d1lvuc_: 1lvu C: [91148]

Details for d1lvuc_

PDB Entry: 1lvu, 2.05 Å

PDB Description: crystal structure of calf spleen purine nucleoside phosphorylase in a new space group with full trimer in the asymmetric unit

PDB Compounds: (C:) purine nucleoside phosphorylase

SCOP Domain Sequences for d1lvuc_:

Sequence, based on SEQRES records:

>d1lvuc_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}
mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
itnkvimdyesqgkanheevleagkqaaqkleqfvsllmasipv

Sequence, based on observed residues (ATOM records):

>d1lvuc_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}
mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
itnkvimdyesqgkqaaqkleqfvsllmasipv

Timeline for d1lvuc_:

• d1lvuc_ first appeared in SCOP 1.67
  
• d1lvuc_ appears in SCOP 1.71
  
• d1lvuc_ appears in SCOP 1.75
  
• d1lvuc_ appears in the current release, SCOPe 2.08