Lineage for d1lvnb3 (1lvn B:186-300)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1404785Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1404786Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1404787Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1404917Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)
  8. 1404965Domain d1lvnb3: 1lvn B:186-300 [91144]
    Other proteins in same PDB: d1lvna1, d1lvna4, d1lvnb1, d1lvnb4
    complexed with ca, cu

Details for d1lvnb3

PDB Entry: 1lvn (more details), 2.4 Å

PDB Description: crystal structure of e. coli amine oxidase complexed with tranylcypromine
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1lvnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvnb3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

SCOPe Domain Coordinates for d1lvnb3:

Click to download the PDB-style file with coordinates for d1lvnb3.
(The format of our PDB-style files is described here.)

Timeline for d1lvnb3: