Lineage for d1lvnb1 (1lvn B:301-725)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309061Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1309062Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1309063Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1309064Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1309130Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 1309154Domain d1lvnb1: 1lvn B:301-725 [91142]
    Other proteins in same PDB: d1lvna2, d1lvna3, d1lvna4, d1lvnb2, d1lvnb3, d1lvnb4
    complexed with ca, cu

Details for d1lvnb1

PDB Entry: 1lvn (more details), 2.4 Å

PDB Description: crystal structure of e. coli amine oxidase complexed with tranylcypromine
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1lvnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvnb1 b.30.2.1 (B:301-725) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkk

SCOPe Domain Coordinates for d1lvnb1:

Click to download the PDB-style file with coordinates for d1lvnb1.
(The format of our PDB-style files is described here.)

Timeline for d1lvnb1: