Lineage for d1lvna4 (1lvn A:7-90)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527780Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2527781Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
    automatically mapped to Pfam PF07833
  5. 2527782Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 2527783Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 2527784Species Escherichia coli [TaxId:562] [55386] (16 PDB entries)
  8. 2527815Domain d1lvna4: 1lvn A:7-90 [91141]
    Other proteins in same PDB: d1lvna1, d1lvna2, d1lvna3, d1lvnb1, d1lvnb2, d1lvnb3
    complexed with ca, cu

Details for d1lvna4

PDB Entry: 1lvn (more details), 2.4 Å

PDB Description: crystal structure of e. coli amine oxidase complexed with tranylcypromine
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d1lvna4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvna4 d.82.1.1 (A:7-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
kawvsdtfindvfqsgldqtfqve

SCOPe Domain Coordinates for d1lvna4:

Click to download the PDB-style file with coordinates for d1lvna4.
(The format of our PDB-style files is described here.)

Timeline for d1lvna4: