SCOPe 2.03: Domain d1lv0a2: 1lv0 A:292-388

Lineage for d1lv0a2 (1lv0 A:292-388)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.6: GDI-like [54399] (2 proteins)
   Similar to FAD-linked reductases in both domains but does not bind FAD

6. Protein Guanine nucleotide dissociation inhibitor, GDI [54400] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54401] (3 PDB entries)

8. Domain d1lv0a2: 1lv0 A:292-388 [91131]
   Other proteins in same PDB: d1lv0a1
   complexed with ger, so4

Details for d1lv0a2

PDB Entry: 1lv0, 2 Å

PDB Description: Crystal structure of the Rab effector guanine nucleotide dissociation inhibitor (GDI) in complex with a geranylgeranyl (GG) peptide

PDB Compounds: (A:) RAB GDP disossociation inhibitor alpha

SCOPe Domain Sequences for d1lv0a2:

Sequence; same for both SEQRES and ATOM records:

>d1lv0a2 d.16.1.6 (A:292-388) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]}
rkagqviriicilshpikntndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyia
iasttvettdpekevepalellepidqkfvaisdlye

Timeline for d1lv0a2:

• d1lv0a2 first appeared in SCOP 1.67
  
• d1lv0a2 appears in SCOPe 2.02
  
• d1lv0a2 appears in SCOPe 2.04
  
• d1lv0a2 appears in the current release, SCOPe 2.08