SCOPe 2.04: Domain d1lv0a1: 1lv0 A:-1-291,A:389-431

Lineage for d1lv0a1 (1lv0 A:-1-291,A:389-431)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.3: GDI-like N domain [51931] (3 proteins)
   Similar to FAD-linked reductases in both domains but does not bind FAD

6. Protein Guanine nucleotide dissociation inhibitor, GDI [51932] (2 species)
   the inhibition function is probably associated with an insert subdomain, residues 120-220

7. Species Cow (Bos taurus) [TaxId:9913] [51933] (3 PDB entries)

8. Domain d1lv0a1: 1lv0 A:-1-291,A:389-431 [91130]
   Other proteins in same PDB: d1lv0a2
   complexed with ger, so4

Details for d1lv0a1

PDB Entry: 1lv0, 2 Å

PDB Description: Crystal structure of the Rab effector guanine nucleotide dissociation inhibitor (GDI) in complex with a geranylgeranyl (GG) peptide

PDB Compounds: (A:) RAB GDP disossociation inhibitor alpha

SCOPe Domain Sequences for d1lv0a1:

Sequence; same for both SEQRES and ATOM records:

>d1lv0a1 c.3.1.3 (A:-1-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]}
hhmdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfql
legppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiyk
vpstetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlg
qdvidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgf
arlsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvXpiddgs
esqvfcscsydatthfettcndikdiykrmagsafdf

Timeline for d1lv0a1:

• d1lv0a1 first appeared in SCOP 1.67
  
• d1lv0a1 appears in SCOPe 2.03
  
• d1lv0a1 appears in SCOPe 2.05
  
• d1lv0a1 appears in the current release, SCOPe 2.08