Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.3: GDI-like N domain [51931] (3 proteins) Similar to FAD-linked reductases in both domains but does not bind FAD |
Protein Guanine nucleotide dissociation inhibitor, GDI [51932] (2 species) the inhibition function is probably associated with an insert subdomain, residues 120-220 |
Species Cow (Bos taurus) [TaxId:9913] [51933] (3 PDB entries) |
Domain d1lv0a1: 1lv0 A:-1-291,A:389-431 [91130] Other proteins in same PDB: d1lv0a2 complexed with ger, so4 |
PDB Entry: 1lv0 (more details), 2 Å
SCOPe Domain Sequences for d1lv0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lv0a1 c.3.1.3 (A:-1-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} hhmdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfql legppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiyk vpstetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlg qdvidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgf arlsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvXpiddgs esqvfcscsydatthfettcndikdiykrmagsafdf
Timeline for d1lv0a1: