SCOPe 2.06: Domain d1lu4a_: 1lu4 A:

Lineage for d1lu4a_ (1lu4 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Soluble secreted antigen MPT53 [102457] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [102458] (1 PDB entry)

8. Domain d1lu4a_: 1lu4 A: [91124]

Details for d1lu4a_

PDB Entry: 1lu4, 1.12 Å

PDB Description: 1.1 angstrom resolution crystal structure of a secreted mycobacterium tuberculosis disulfide oxidoreductase homologous to e. coli dsbe: implications for functions

PDB Compounds: (A:) soluble secreted antigen mpt53

SCOPe Domain Sequences for d1lu4a_:

Sequence; same for both SEQRES and ATOM records:

>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]}
aderlqftattlsgapfdgaslqgkpavlwfwtpwcpfcnaeapslsqvaaanpavtfvg
iatradvgamqsfvskynlnftnlndadgviwarynvpwqpafvfyradgtstfvnnpta
amsqdelsgrvaal

Timeline for d1lu4a_:

• d1lu4a_ first appeared in SCOP 1.67
  
• d1lu4a_ appears in SCOPe 2.05
  
• d1lu4a_ appears in SCOPe 2.07
  
• d1lu4a_ appears in the current release, SCOPe 2.08