SCOP 1.67: Domain d1lsoa2: 1lso A:12-203

Lineage for d1lsoa2 (1lso A:12-203)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (13 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51875] (11 PDB entries)

8. Domain d1lsoa2: 1lso A:12-203 [91121]
   Other proteins in same PDB: d1lsoa1, d1lsob1

Details for d1lsoa2

PDB Entry: 1lso, 2.6 Å

PDB Description: crystal structure of the s137a mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad

SCOP Domain Sequences for d1lsoa2:

Sequence; same for both SEQRES and ATOM records:

>d1lsoa2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)}
kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
fasntaslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska
lgkhpvsckdtp

Timeline for d1lsoa2:

• d1lsoa2 is new in SCOP 1.67
  
• d1lsoa2 appears in SCOP 1.69
  
• d1lsoa2 appears in the current release, SCOPe 2.08