SCOP 1.71: Domain d1lsjb1: 1lsj B:204-302

Lineage for d1lsjb1 (1lsj B:204-302)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (10 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
   Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI

7. Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries)

8. Domain d1lsjb1: 1lsj B:204-302 [91118]
   Other proteins in same PDB: d1lsja2, d1lsjb2
   complexed with nad; mutant

Details for d1lsjb1

PDB Entry: 1lsj, 2.5 Å

PDB Description: crystal structure of the e110q mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad

SCOP Domain Sequences for d1lsjb1:

Sequence; same for both SEQRES and ATOM records:

>d1lsjb1 a.100.1.3 (B:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

Timeline for d1lsjb1:

• d1lsjb1 first appeared in SCOP 1.67
  
• d1lsjb1 appears in SCOP 1.69
  
• d1lsjb1 appears in SCOP 1.73
  
• d1lsjb1 appears in the current release, SCOPe 2.08