Lineage for d1ls6a_ (1ls6 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484015Family c.37.1.5: PAPS sulfotransferase [52575] (12 proteins)
    Pfam 00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 484016Protein Aryl sulfotransferase sult1a [102346] (1 species)
  7. 484017Species Human (Homo sapiens) [TaxId:9606] [102347] (1 PDB entry)
  8. 484018Domain d1ls6a_: 1ls6 A: [91115]

Details for d1ls6a_

PDB Entry: 1ls6 (more details), 1.9 Å

PDB Description: Human SULT1A1 complexed with PAP and p-Nitrophenol

SCOP Domain Sequences for d1ls6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ls6a_ c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human (Homo sapiens)}
srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttvpqef
mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel

SCOP Domain Coordinates for d1ls6a_:

Click to download the PDB-style file with coordinates for d1ls6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ls6a_: