Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
Protein Methanol dehydrogenase, light chain [48668] (3 species) |
Species Paracoccus denitrificans [TaxId:266] [101493] (1 PDB entry) |
Domain d1lrwb_: 1lrw B: [91112] Other proteins in same PDB: d1lrwa_, d1lrwc_ complexed with ca, pqq |
PDB Entry: 1lrw (more details), 2.5 Å
SCOPe Domain Sequences for d1lrwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lrwb_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Paracoccus denitrificans [TaxId: 266]} ydgtnckapgncwepkpdypakvegskydpqhdpaelskqgeslavmdarnewrvwnmkk tgkfeydvkkidgydetkappae
Timeline for d1lrwb_: