Lineage for d1lrwa_ (1lrw A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066580Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2066581Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 protein domains)
  6. 2066588Protein Methanol dehydrogenase, heavy chain [51000] (3 species)
  7. 2066611Species Paracoccus denitrificans [TaxId:266] [101916] (1 PDB entry)
  8. 2066612Domain d1lrwa_: 1lrw A: [91111]
    Other proteins in same PDB: d1lrwb_, d1lrwd_
    complexed with ca, pqq

Details for d1lrwa_

PDB Entry: 1lrw (more details), 2.5 Å

PDB Description: Crystal structure of methanol dehydrogenase from P. denitrificans
PDB Compounds: (A:) methanol dehydrogenase subunit 1

SCOPe Domain Sequences for d1lrwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrwa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Paracoccus denitrificans [TaxId: 266]}
ndqlvelakdpanwvmtgrdynaqnysemtdinkenvkqlrpawsfstgvlhghegtplv
vgdrmfihtpfpnttfaldlnepgkilwqnkpkqnptartvaccdvvnrglaywpgddqv
kplifrtqldghivamdaetgetrwimensdikvgstltiapyvikdlvlvgssgaelgv
rgyvtaydvksgemrwrafatgpdeelllaedfnapnphygqknlgletwegdawkiggg
tnwgwyaydpevdlfyygsgnpapwnetmrpgdnkwtmaiwgreattgeakfayqktphd
ewdyagvnvmmlseqedkqgqmrkllthpdrngivytldrtngdlisadkmddtvnwvke
vqldtglpvrdpefgtrmdhkardicpsamgyhnqghdsydperkvfmlginhicmdwep
fmlpyragqffvgatltmypgpkgdrgnasglgqikaydaisgemkwekmerfsvwggtm
ataggltfyatldgfikardsdtgdllwkfklpsgvighpmtykhdgrqyvaimygvggw
pgvglvfdladptaglgsvgafkrlqeftqmgggvmvfsldgespysdpnvgeyapgept

SCOPe Domain Coordinates for d1lrwa_:

Click to download the PDB-style file with coordinates for d1lrwa_.
(The format of our PDB-style files is described here.)

Timeline for d1lrwa_: