Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (3 families) |
Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins) |
Protein Hypothetical protein MPN625 [103273] (2 species) |
Species Mycoplasma pneumoniae [TaxId:2104] [103274] (1 PDB entry) |
Domain d1lqlf1: 1lql F:1001-1141 [91106] Other proteins in same PDB: d1lqlc2, d1lqld2, d1lqlf2, d1lqli2, d1lqlj2 structural genomics |
PDB Entry: 1lql (more details), 2.85 Å
SCOPe Domain Sequences for d1lqlf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqlf1 d.227.1.1 (F:1001-1141) Hypothetical protein MPN625 {Mycoplasma pneumoniae [TaxId: 2104]} mdkkyditavlnedssmtaisdqfqitldarpkhtakgfgplaallsglaacelatanlm apakmitinkllmnvtgsrstnptdgyfglreinlhweihspnseteikefidfvskrcp ahntlqgvsqlkinvnvtlvh
Timeline for d1lqlf1: