Lineage for d1lqld_ (1lql D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446836Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 1446837Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 1446838Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)
  6. 1446843Protein Hypothetical protein MPN625 [103273] (2 species)
  7. 1446844Species Mycoplasma pneumoniae [TaxId:2104] [103274] (1 PDB entry)
  8. 1446848Domain d1lqld_: 1lql D: [91104]
    structural genomics

Details for d1lqld_

PDB Entry: 1lql (more details), 2.85 Å

PDB Description: Crystal structure of OsmC like protein from Mycoplasma pneumoniae
PDB Compounds: (D:) osmotical inducible protein C like family

SCOPe Domain Sequences for d1lqld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqld_ d.227.1.1 (D:) Hypothetical protein MPN625 {Mycoplasma pneumoniae [TaxId: 2104]}
yfqghmdkkyditavlnedssmtaisdqfqitldarpkhtakgfgplaallsglaacela
tanlmapakmitinkllmnvtgsrstnptdgyfglreinlhweihspnseteikefidfv
skrcpahntlqgvsqlkinvnvtlvh

SCOPe Domain Coordinates for d1lqld_:

Click to download the PDB-style file with coordinates for d1lqld_.
(The format of our PDB-style files is described here.)

Timeline for d1lqld_: