![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
![]() | Superfamily d.227.1: OsmC-like [82784] (3 families) ![]() |
![]() | Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins) |
![]() | Protein Hypothetical protein MPN625 [103273] (2 species) |
![]() | Species Mycoplasma pneumoniae [TaxId:2104] [103274] (1 PDB entry) |
![]() | Domain d1lqlb_: 1lql B: [91102] Other proteins in same PDB: d1lqlc2, d1lqld2, d1lqlf2, d1lqli2, d1lqlj2 structural genomics |
PDB Entry: 1lql (more details), 2.85 Å
SCOPe Domain Sequences for d1lqlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqlb_ d.227.1.1 (B:) Hypothetical protein MPN625 {Mycoplasma pneumoniae [TaxId: 2104]} mdkkyditavlnedssmtaisdqfqitldarpkhtakgfgplaallsglaacelatanlm apakmitinkllmnvtgsrstnptdgyfglreinlhweihspnseteikefidfvskrcp ahntlqgvsqlkinvnvtlvh
Timeline for d1lqlb_: