Lineage for d1lq2a2 (1lq2 A:389-602)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692381Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain [52279] (1 family) (S)
  5. 692382Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain [52280] (1 protein)
  6. 692383Protein Beta-D-glucan exohydrolase, C-terminal domain [52281] (1 species)
    interdomain linker forms an additional, N-terminal strand
  7. 692384Species Barley (Hordeum vulgare) [TaxId:4513] [52282] (9 PDB entries)
  8. 692393Domain d1lq2a2: 1lq2 A:389-602 [91100]
    Other proteins in same PDB: d1lq2a1
    complexed with fuc, gol, idd, man, nag

Details for d1lq2a2

PDB Entry: 1lq2 (more details), 2.7 Å

PDB Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole
PDB Compounds: (A:) beta-d-glucan glucohydrolase isoenzyme exo1

SCOP Domain Sequences for d1lq2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lq2a2 c.23.11.1 (A:389-602) Beta-D-glucan exohydrolase, C-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiewqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnat

SCOP Domain Coordinates for d1lq2a2:

Click to download the PDB-style file with coordinates for d1lq2a2.
(The format of our PDB-style files is described here.)

Timeline for d1lq2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lq2a1