SCOPe 2.05: Domain d1lpda_: 1lpd A:

Lineage for d1lpda_ (1lpd A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein Dianthin 30 [103335] (1 species)

7. Species Clove pink (Dianthus caryophyllus) [TaxId:3570] [103336] (4 PDB entries)
   Uniprot P24476 24-278

8. Domain d1lpda_: 1lpd A: [91098]
   complexed with ade

Details for d1lpda_

PDB Entry: 1lpd, 1.7 Å

PDB Description: high resolution structure of recombinant dianthin antiviral protein-potent anti-hiv agent (complex with adenine)

PDB Compounds: (A:) Dianthin 30

SCOPe Domain Sequences for d1lpda_:

Sequence; same for both SEQRES and ATOM records:

>d1lpda_ d.165.1.1 (A:) Dianthin 30 {Clove pink (Dianthus caryophyllus) [TaxId: 3570]}
ataytlnlanpsasqyssfldqirnnvrdtsliyggtdvevigapsttdkflrlnfqgpr
gtvslglrrenlyvvaylamdnanvnrayyfknqitsaeltalfpevvvanqkqleyged
yqaieknakittgdqsrkelglginllitmidgvnkkvrvvkdearflliaiqmtaeaar
fryiqnlvtknfpnkfdsenkviqfqvswskistaifgdckngvfnkdydfgfgkvrqak
dlqmgllkylgrpk

Timeline for d1lpda_:

• d1lpda_ first appeared in SCOP 1.67
  
• d1lpda_ appears in SCOPe 2.04
  
• d1lpda_ appears in SCOPe 2.06
  
• d1lpda_ appears in the current release, SCOPe 2.08