Lineage for d1lpda_ (1lpd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000033Protein Dianthin 30 [103335] (1 species)
  7. 3000034Species Clove pink (Dianthus caryophyllus) [TaxId:3570] [103336] (4 PDB entries)
    Uniprot P24476 24-278
  8. 3000037Domain d1lpda_: 1lpd A: [91098]
    complexed with ade

Details for d1lpda_

PDB Entry: 1lpd (more details), 1.7 Å

PDB Description: high resolution structure of recombinant dianthin antiviral protein-potent anti-hiv agent (complex with adenine)
PDB Compounds: (A:) Dianthin 30

SCOPe Domain Sequences for d1lpda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpda_ d.165.1.1 (A:) Dianthin 30 {Clove pink (Dianthus caryophyllus) [TaxId: 3570]}
ataytlnlanpsasqyssfldqirnnvrdtsliyggtdvevigapsttdkflrlnfqgpr
gtvslglrrenlyvvaylamdnanvnrayyfknqitsaeltalfpevvvanqkqleyged
yqaieknakittgdqsrkelglginllitmidgvnkkvrvvkdearflliaiqmtaeaar
fryiqnlvtknfpnkfdsenkviqfqvswskistaifgdckngvfnkdydfgfgkvrqak
dlqmgllkylgrpk

SCOPe Domain Coordinates for d1lpda_:

Click to download the PDB-style file with coordinates for d1lpda_.
(The format of our PDB-style files is described here.)

Timeline for d1lpda_: